Antibodies

Jump to Filters
View as table Download
KIF13B Rabbit Polyclonal Antibody
TA334698

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIF13B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF13B antibody: synthetic peptide directed towards the N terminal of human KIF13B. Synthetic peptide located within the following region: SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE