KIF13B Rabbit Polyclonal Antibody

CAT#: TA334698

Rabbit Polyclonal Anti-KIF13B Antibody

Product Images

WB Suggested Anti-KIF13B Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysateKIF13B is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-KIF13B Antibody; Paraffin Embedded Tissue: Human Prostate; Antibody Concentration: 5 ug/ml

• 

  Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-KIF13B antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KIF13B antibody: synthetic peptide directed towards the N terminal of human KIF13B. Synthetic peptide located within the following region: SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 203 kDa
• Gene Name: kinesin family member 13B
• Database Link:
  NP_056069
  Entrez Gene 23303 Human
  UniProt ID Q9NQT8
• Background: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.
• Synonyms: GAKIN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%

Reference Data

• Protein Families: Druggable Genome