LGALS4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LGALS4 |
LGALS4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LGALS4 |
Rabbit polyclonal anti-LEG4 antibody
Applications | IHC, WB |
Reactivities | WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:20000 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LEG4. |
Rabbit Polyclonal Anti-Lgals4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS |
LGALS4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LGALS4 |
Galectin 4/LGALS4 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Galectin 4/LGALS4 (NP_006140.1). |