Antibodies

View as table Download

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

Rabbit polyclonal anti-MASP2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MASP2.

Rabbit Polyclonal Anti-Masp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT

Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI4D4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI5C4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI7C4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI7D4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MASP2 mouse monoclonal antibody,clone OTI2F10

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2

MASP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MASP2

MASP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 445-686 of human MASP2 (NP_006601.2).
Modifications Unmodified

MASP2 mouse monoclonal antibody,clone OTI4D4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI4D4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI5C4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI5C4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI7C4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI7C4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI7D4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI7D4

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI2F10

Applications WB
Reactivities Human
Conjugation Unconjugated

MASP2 mouse monoclonal antibody,clone OTI2F10

Applications WB
Reactivities Human
Conjugation Unconjugated