Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-MAVS Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAVS |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Mouse Monoclonal MAVS Antibody (58N2B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MAVS mouse monoclonal antibody, clone OTI9C7 (formerly 9C7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MAVS
Conjugates
- Unconjugated