Antibodies

Jump to Filters
View as table Download
OMA1 Rabbit Polyclonal Antibody
TA340395

USD 375.00

In Stock

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Fish, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
OMA1 Rabbit Polyclonal Antibody
TA379465

USD 220.00

3 Weeks

OMA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-524 of human OMA1 (NP_660286.1).
Modifications Unmodified