OMA1 Rabbit Polyclonal Antibody

CAT#: TA340395

Rabbit Polyclonal Anti-OMA1 Antibody

Product Images

Sample Type: HepG2 cells; Primary Dilution: 1: 1000; Secondary Antibody: anti-Rabbit TBST with 5% BSA; Secondary Dilution: 1: 5000; Image Submitted by: Hana Sabic; University of Utah�

• 

  Lanes: Lane 1: 10ug human fibroblast mitochondria; Lane 2: 15ug fish embryo lysate; 6h post fertilization; Lane 3: 30ug fish embryo lysate, 6 days; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-Rabbit HRP; Secondary Antibody Dilution: 1: 5000;

• 

  WB Suggested Anti-OMA1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Fish, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60
• Gene Name: OMA1 zinc metallopeptidase
• Database Link:
  NP_660286
  Entrez Gene 115209 Human
  UniProt ID Q96E52
• Background: OMA1 is a mitochondrial protease.
• Synonyms: 2010001O09Rik; DAB1; MPRP-1; peptidase; YKR087C; ZMPOMA1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Bovine: 85%; Zebrafish: 85%; Yeast: 83%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane