Germany
Japan
United Kingdom
China
Rabbit anti-PDLIM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDLIM5 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PDLIM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: RTGTTQSRSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVAST |
Rabbit Polyclonal Anti-PDLIM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: VKIPPKRPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQS |
Rabbit Polyclonal Anti-PDLIM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the N terminal of human PDLIM5. Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL |
Rabbit Polyclonal Anti-PDLIM5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the C terminal of human PDLIM5. Synthetic peptide located within the following region: AGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF |
Carrier-free (BSA/glycerol-free) PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDLIM5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PDLIM5 |
PDLIM5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PDLIM5 |
PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PDLIM5
Conjugates
- Unconjugated