Antibodies

Jump to Filters
View as table Download
PLAC8 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
CF810807

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PLAC8 mouse monoclonal antibody,clone OTI2E10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PLAC8 Rabbit Polyclonal Antibody
TA356698

USD 360.00

5 Days

PLAC8 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC
PLAC8 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
TA810807

USD 379.00

In Stock

PLAC8 mouse monoclonal antibody,clone OTI2E10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PLAC8 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
TA810807S

USD 159.00

2 Days

PLAC8 mouse monoclonal antibody,clone OTI2E10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated