Carrier-free (BSA/glycerol-free) PLAC8 mouse monoclonal antibody,clone OTI2E10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLAC8 mouse monoclonal antibody,clone OTI2E10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLAC8 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC |
PLAC8 mouse monoclonal antibody,clone OTI2E10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLAC8 mouse monoclonal antibody,clone OTI2E10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |