PLAC8 Rabbit Polyclonal Antibody

CAT#: TA356698

PLAC8 Antibody


USD 360.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PLAC8"

Specifications

Product Data
Applications IHC
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen is a synthetic peptide directed towards the following sequence AQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGC
Specificity Expected reactivity: Cow, Human
Homology: Cow: 93%; Human: 100%
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size 13 kDa
Gene Name placenta specific 8
Synonyms C15; onzin
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.