Antibodies

View as table Download

Rabbit polyclonal CLIC4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CLIC4.

Goat Polyclonal Antibody against CLIC4

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence NGLKEEDKEPLIE-C, from the N Terminus of the protein sequence according to NP_039234.1.

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Rabbit Polyclonal Anti-CLIC4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLIC4