CLIC4 Rabbit Polyclonal Antibody

CAT#: TA338569

Rabbit Polyclonal Anti-CLIC4 Antibody

Product Images

WB Suggested Anti-CLIC4 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4. Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: chloride intracellular channel 4
• Database Link:
  NP_039234
  Entrez Gene 25932 Human
  UniProt ID Q9Y696
• Background: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008]
• Synonyms: CLIC4L; H1; huH1; MTCLIC; p64H1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Dog: 92%; Zebrafish: 82%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other