Rabbit Polyclonal Anti-DCX Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: PEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRR |
Rabbit Polyclonal Anti-DCX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCX antibody: synthetic peptide directed towards the C terminal of human DCX. Synthetic peptide located within the following region: TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPIS |
Anti-DCX Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.413~417( P-T-S-P-G) derived from Human Doublecortin. |
Germany
Japan
United Kingdom
China
