Antibodies

View as table Download

Rabbit Polyclonal HIF Prolyl Hydroxylase 3 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues between 50-100 of human Prolyl Hydroxylase Domain-Containing Protein 3 using the numbering given in entry NP_071356.1 (GeneID 112399).

Goat Polyclonal Antibody against EGLN3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLGKYYVKERSK, from the internal region of the protein sequence according to NP_071356.1.

Rabbit Polyclonal Anti-EGLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT

Anti-EGLN3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein