PHD3 (EGLN3) Rabbit Polyclonal Antibody

CAT#: TA340195

Rabbit Polyclonal Anti-EGLN3 Antibody

Product Images

WB Suggested Anti-EGLN3 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: egl-9 family hypoxia inducible factor 3
• Database Link:
  NP_071356
  Entrez Gene 112399 Human
  UniProt ID Q9H6Z9
• Background: EGLN3 catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-564', and HIF-2 alpha. EGLN3 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation in muscle cells and in apoptosis in neuronal tissue. EGLN3 promotes cell death through a caspase-dependent mechanism.
• Synonyms: HIFP4H3; HIFPH3; PHD3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 77%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Pathways in cancer, Renal cell carcinoma