Goat Polyclonal Antibody against MELK
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KRLVEDILSSCKV, from the C Terminus of the protein sequence according to NP_055606.1. |
Goat Polyclonal Antibody against MELK
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KRLVEDILSSCKV, from the C Terminus of the protein sequence according to NP_055606.1. |
Rabbit Polyclonal Anti-MELK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK. Synthetic peptide located within the following region: AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK |