Antibodies

Jump to Filters
View as table Download
MELK Goat Polyclonal Antibody
TA302675

USD 375.00

5 Days

Goat Polyclonal Antibody against MELK

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KRLVEDILSSCKV, from the C Terminus of the protein sequence according to NP_055606.1.
MELK Rabbit Polyclonal Antibody
TA339317

USD 375.00

5 Days

Rabbit Polyclonal Anti-MELK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MELK antibody: synthetic peptide directed towards the middle region of human MELK. Synthetic peptide located within the following region: AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK