Antibodies

View as table Download

Rabbit polyclonal anti-MYF6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MYF6.

Rabbit Polyclonal Anti-MYF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the N terminal of human MYF6. Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA

Rabbit Polyclonal anti-MYF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the middle region of human MYF6. Synthetic peptide located within the following region: LQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDH