Antibodies

Jump to Filters
View as table Download
RAB3D Rabbit Polyclonal Antibody
TA330003

USD 310.00

5 Days

Rabbit Polyclonal Anti-RAB3D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB3D antibody: synthetic peptide directed towards the C terminal of human RAB3D. Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS
RAB3D Rabbit Polyclonal Antibody
TA322774

USD 345.00

In Stock

Anti-Rab3D Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 202-216 amino acids of Human RAB3D, member RAS oncogene family