Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-Rab8b Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8b produced in E. coli.

Rabbit Polyclonal Anti-RAB8B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS

Rabbit Polyclonal Anti-RAB8B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK

Rabbit Polyclonal Anti-RAB8B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB8B