Antibodies

View as table Download

Rabbit polyclonal anti-RHOB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RHOB.

Rabbit Polyclonal Anti-RHOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOB antibody: synthetic peptide directed towards the middle region of human RHOB. Synthetic peptide located within the following region: CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Anti-RHOB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-188 amino acids of Human Ras homolog family member B