Antibodies

View as table Download

Rabbit Polyclonal Anti-RNF34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF34 antibody: synthetic peptide directed towards the middle region of human RNF34. Synthetic peptide located within the following region: LVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSS

RNF34 rabbit polyclonal antibody, Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Immunogen Recombinant protein corresponding to amino acids 1-373 of human RFI.

Goat Anti-RNF34 / RFI (N Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KAGATSMWASCC, from the N Terminus of the protein sequence according to NP_919247.1; NP_079402.2.

Rabbit polyclonal anti-RNF34 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-373 of human RNF34 protein.