Antibodies

Jump to Filters
View as table Download
SETD2 Rabbit Polyclonal Antibody
TA342447

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-SETD2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SETD2 antibody: synthetic peptide directed towards the N terminal of human SETD2. Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD
SETD2 Rabbit Polyclonal Antibody
TA349531

USD 345.00

In Stock

Rabbit Polyclonal Anti-SETD2 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SETD2