SETD2 Rabbit Polyclonal Antibody

CAT#: TA342447

Rabbit Polyclonal Anti-SETD2 Antibody

Product Images

Human HepG2 cellsSETD2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  SETD2 antibody - N-terminal region validated by IHC using Human Placenta lysate at 4.0-8.0.

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SETD2 antibody: synthetic peptide directed towards the N terminal of human SETD2. Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: SET domain containing 2
• Database Link:
  NP_054878
  Entrez Gene 29072 Human
  UniProt ID Q9BYW2
• Background: Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II. [provided by RefSeq, Aug 2008]
• Synonyms: HBP231; HIF-1; HIP-1; HSPC069; HYPB; KMT3A; LLS; p231HBP; SET2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Rat: 85%; Mouse: 83%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Lysine degradation