Antibodies

View as table Download

SGK3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Gorilla, Hamster, Human, Mouse, Orang-Utan, Rat
Immunogen SGK3 antibody was raised against synthetic 20 amino acid peptide from internal region of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bat (100%); Monkey, Marmoset, Elephant, Bovine, Horse, Rabbit (95%); Turkey, Chicken, Platypus (90%); Opossum, Lizard (85%).

Rabbit polyclonal Anti-SGK3 Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-SGK3 antibody: synthetic peptide directed towards the N terminal of human SGK3. Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH