SGK3 Rabbit Polyclonal Antibody

CAT#: TA330948

Rabbit polyclonal Anti-SGK3 Antibody

Product Images

WB Suggested Anti-SGK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: SH-SYSY cell lysate

• 

  Human Spleen

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGK3 antibody: synthetic peptide directed towards the N terminal of human SGK3. Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: serum/glucocorticoid regulated kinase family member 3
• Database Link:
  NP_733827
  Entrez Gene 23678 Human
• Background: The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: CISK; SGK2; SGKL
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase