Antibodies

Jump to Filters
View as table Download
Transglutaminase 4 (TGM4) Rabbit Polyclonal Antibody
TA346348

USD 475.00

5 Days

Rabbit Polyclonal Anti-TGM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TGM4 antibody: synthetic peptide directed towards the N terminal of human TGM4. Synthetic peptide located within the following region: KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
Transglutaminase 4 (TGM4) Rabbit Polyclonal Antibody
TA350532

USD 345.00

In Stock

Rabbit Polyclonal Anti-TGM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TGM4
Transglutaminase 4 (TGM4) Rabbit Polyclonal Antibody
TA351798

USD 345.00

In Stock

Rabbit Polyclonal Anti-TGM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TGM4