Transglutaminase 4 (TGM4) Rabbit Polyclonal Antibody

CAT#: TA346348

Rabbit Polyclonal Anti-TGM4 Antibody

Product Images

WB Suggested Anti-TGM4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysateTGM4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

• 

  Sample Type: Normal Human Prostate; Primary Antibody Dilution: 2 ug/mL; Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue); Gene Name: TGM4;

• 

  Sample Type: Normal Human Prostate; Primary Antibody Dilution: 2 ug/mL; Color/Signal Descriptions: TGM4 (DAB; brown), nuclei (hematoxylin; blue); Gene Name: TGM4;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TGM4 antibody: synthetic peptide directed towards the N terminal of human TGM4. Synthetic peptide located within the following region: KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: transglutaminase 4
• Database Link:
  NP_003232
  Entrez Gene 7047 Human
  UniProt ID P49221
• Background: TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.
• Synonyms: hTGP; TGP
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 83%; Zebrafish: 82%; Pig: 75%; Rat: 75%; Guinea pig: 75%

Reference Data

• Protein Families: Druggable Genome