Antibodies

Jump to Filters
View as table Download
TIA1 Rabbit Polyclonal Antibody
TA343914

USD 475.00

5 Days

Rabbit Polyclonal Anti-TIA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the N terminal of human TIA1. Synthetic peptide located within the following region: MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED
TIA1 Rabbit Polyclonal Antibody
TA343915

USD 475.00

5 Days

Rabbit Polyclonal Anti-TIA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TIA1 antibody: synthetic peptide directed towards the C terminal of human TIA1. Synthetic peptide located within the following region: QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
TIA1 Goat Polyclonal Antibody
TA303222

USD 375.00

5 Days

Goat Polyclonal Antibody against TIA1

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PKSTYESNTKQ, from the internal region of the protein sequence according to NP_071320.1; NP_071505.1.