Antibodies

Jump to Filters
View as table Download
CBR1 Goat Polyclonal Antibody
TA302807

USD 375.00

In Stock

Goat Polyclonal Antibody against CBR1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HGQFVSEKRVEQW, from the C Terminus of the protein sequence according to NP_001748.1.
CBR1 Rabbit Polyclonal Antibody
TA311915

USD 345.00

In Stock

Rabbit polyclonal anti-CBR1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CBR1.
CBR1 Rabbit Polyclonal Antibody
TA332691

USD 275.00

3 Weeks

Rabbit anti-CBR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CBR1
CBR1 Mouse Monoclonal Antibody [Clone ID: 2C9-B12-C4]
TA346903

USD 380.00

4 Weeks

Mouse Monoclonal CBR1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
CBR1 Mouse Monoclonal Antibody [Clone ID: 2C9-B12-C4]
TA346903S

USD 85.00

4 Weeks

Mouse Monoclonal CBR1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
CBR1 Mouse Monoclonal Antibody [Clone ID: AT4E12]
AM09388PU-N

USD 340.00

2 Weeks

CBR1 mouse monoclonal antibody, clone AT4E12, Purified

Applications ELISA, WB
Reactivities Human
CBR1 Mouse Monoclonal Antibody [Clone ID: AT4E12]
AM09388PU-S

USD 230.00

2 Weeks

CBR1 mouse monoclonal antibody, clone AT4E12, Purified

Applications ELISA, WB
Reactivities Human
CBR1 Rabbit Polyclonal Antibody
TA338913

USD 375.00

5 Days

Rabbit Polyclonal Anti-CBR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the middle region of human CBR1. Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
CBR1 Rabbit Polyclonal Antibody
TA338914

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1. Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
CBR1 Mouse Monoclonal Antibody [Clone ID: OTI4B4]
CF809840

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CBR1 mouse monoclonal antibody, clone OTI4B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CBR1 Rabbit Polyclonal Antibody
TA349648

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CBR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBR1
CBR1 Mouse Monoclonal Antibody [Clone ID: OTI4B4]
TA809840

USD 379.00

In Stock

CBR1 mouse monoclonal antibody,clone OTI4B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CBR1 Mouse Monoclonal Antibody [Clone ID: OTI4B4]
TA809840S

USD 159.00

2 Days

CBR1 mouse monoclonal antibody,clone OTI4B4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".