Antibodies

Jump to Filters
View as table Download
B4GALT1 Rabbit Polyclonal Antibody
TA313920

USD 345.00

4 Weeks

Rabbit polyclonal anti-B4GALT1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1.
GCNT2 (C-term) Rabbit Polyclonal Antibody
AP51803PU-N

USD 450.00

2 Weeks

GCNT2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 371-399 amino acids from the C-terminal region of Human GCNT2 / NACGT1
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA334650

USD 375.00

5 Days

Rabbit Polyclonal Anti-FUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FUT1 antibody: synthetic peptide directed towards the middle region of human FUT1. Synthetic peptide located within the following region: EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
AP17406PU-N

USD 450.00

2 Weeks

Galactoside 2 alpha L fucosyltransferase 1 (FUT1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human FUT1
Galactoside 2 alpha L fucosyltransferase 1 (FUT1) Rabbit Polyclonal Antibody
TA351200

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-FUT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT1