Antibodies

View as table Download

Rabbit Polyclonal Anti-MYL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL3 antibody: synthetic peptide directed towards the N terminal of human MYL3. Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG

Myosin light chain 3 (MYL3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Recombinant human myosin (cardiac) light chain fragment.

Rabbit polyclonal anti-MYL3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MYL3.

Rabbit Polyclonal Anti-MYL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MYL3