DDB2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DDB2 |
DDB2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DDB2 |
Rabbit Polyclonal Anti-DDB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF |
Carrier-free (BSA/glycerol-free) DDB2 mouse monoclonal antibody,clone OTI2E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
DDB2 mouse monoclonal antibody,clone OTI2E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DDB2 mouse monoclonal antibody,clone OTI2E12, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
DDB2 mouse monoclonal antibody,clone OTI2E12, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
DDB2 mouse monoclonal antibody,clone OTI2E12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".