Antibodies

View as table Download

Rabbit polyclonal anti-AKR1C2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKR1C2.

Rabbit Polyclonal Anti-AKR1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK

Rabbit Polyclonal Anti-AKR1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV

Rabbit anti ARK1C2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated