AKR1C2 Rabbit Polyclonal Antibody
Other products for "AKR1C2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | aldo-keto reductase family 1, member C2 |
Database Link | |
Background | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
Synonyms | AKR1C-pseudo; BABP; DD; DD-2; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 91%; Rat: 90%; Mouse: 90% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolism of xenobiotics by cytochrome P450 |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.