Antibodies

View as table Download

AKR1C2 mouse monoclonal antibody, clone T101

Applications ELISA, IF, IHC, WB
Reactivities Human, Mammalian, Mouse, Porcine

Rabbit polyclonal anti-AKR1C2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKR1C2.

Rabbit Polyclonal Anti-AKR1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK

Rabbit Polyclonal Anti-AKR1C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV

Rabbit anti ARK1C2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AKR1C2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C2 (NP_995317.1).
Modifications Unmodified