Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-AKR1C2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AKR1C2. |
Rabbit Polyclonal Anti-AKR1C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK |
Rabbit Polyclonal Anti-AKR1C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1C2 antibody: synthetic peptide directed towards the N terminal of human AKR1C2. Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV |
Rabbit anti ARK1C2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
AKR1C2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C2 (NP_995317.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AKR1C2