Antibodies

Jump to Filters
View as table Download
Aquaporin 5 (AQP5) Rabbit Polyclonal Antibody
TA335862

USD 375.00

5 Days

Rabbit Polyclonal Anti-AQP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AQP5 Antibody is: synthetic peptide directed towards the C-terminal region of Human AQP5. Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE
Aquaporin 5 (AQP5) Rabbit Polyclonal Antibody
TA321387

USD 345.00

In Stock

Anti-AQP5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 250-265 amino acids of Human aquaporin 5
Aquaporin 5 (AQP5) Rabbit Polyclonal Antibody
TA321388

USD 345.00

In Stock

Anti-AQP5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 250-265 amino acids of Human Aquaporin-5