Antibodies

Jump to Filters
View as table Download
EIF2AK1 Rabbit Polyclonal Antibody
TA344094

USD 475.00

5 Days

Rabbit Polyclonal Anti-EIF2AK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF2AK1 antibody: synthetic peptide directed towards the N terminal of human EIF2AK1. Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
EIF2AK1 Rabbit Polyclonal Antibody
TA315366

USD 345.00

4 Weeks

Rabbit polyclonal anti-EIF2AK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EIF2AK1.