Antibodies

Jump to Filters
View as table Download
GPR40 (FFAR1) Goat Polyclonal Antibody
TA303026

USD 375.00

In Stock

Goat Polyclonal Antibody against GPR40

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1.
GPR40 (FFAR1) Rabbit Polyclonal Antibody
TA330390

USD 375.00

5 Days

Rabbit Polyclonal Anti-FFAR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV