Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNG4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNG4 antibody: synthetic peptide directed towards the N terminal of human KCNG4. Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP

Rabbit Polyclonal Anti-KCNG4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNG4