Antibodies

View as table Download

Goat Anti-PDPN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKVDGDTQTTVEKD, from the internal region of the protein sequence according to NP_006465.3; NP_938203.2; NP_001006625.1; NP_001006626.1.

Rabbit Polyclonal Anti-PDPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT

Rabbit Polyclonal Anti-PDPN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM

Carrier-free (BSA/glycerol-free) PDPN mouse monoclonal antibody,clone OTI3H5

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PDPN mouse monoclonal antibody,clone OTI7B4

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Podoplanin Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-PDPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDPN

PDPN mouse monoclonal antibody,clone OTI3H5

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

PDPN mouse monoclonal antibody,clone OTI3H5, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

PDPN mouse monoclonal antibody,clone OTI3H5, HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

PDPN mouse monoclonal antibody,clone OTI3H5

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

PDPN mouse monoclonal antibody,clone OTI7B4

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

PDPN mouse monoclonal antibody,clone OTI7B4, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

PDPN mouse monoclonal antibody,clone OTI7B4, HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

PDPN mouse monoclonal antibody,clone OTI7B4

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated