Antibodies

View as table Download

POLB Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLB

Rabbit polyclonal DNA Polymerase β antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DNA Polymerase β.

Rabbit Polyclonal C-RAF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C-RAF

Rabbit Polyclonal DNA Polymerase beta Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human DNA Polymerase beta.

Rabbit polyclonal anti-POLB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptidecorresponding to a region near the C-terminus of the POLβ protein.

Rabbit Polyclonal Anti-POLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLB antibody: synthetic peptide directed towards the middle region of human POLB. Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML