Mouse monoclonal Hsp90 Antibody
Applications | IHC |
Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line |
Conjugation | Unconjugated |
Mouse monoclonal Hsp90 Antibody
Applications | IHC |
Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GABARAP
Applications | WB |
Reactivities | Human, Manducasexta |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
Mouse monoclonal Anti-PCNA Clone PC10
Reactivities | Human, Insect, Saccharomyces pombe |
Conjugation | Unconjugated |