Antibodies

Jump to Filters
View as table Download
EEF1A1 Rabbit Polyclonal Antibody
TA326873

USD 275.00

2 Weeks

EEF1A1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EEF1A1
EEF1A1 Rabbit Polyclonal Antibody
TA346546

USD 410.00

5 Days

Rabbit Polyclonal Anti-EEF1A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EEF1A1 antibody: synthetic peptide directed towards the C terminal of human EEF1A1. Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK