EEF1A1 Rabbit Polyclonal Antibody

CAT#: TA346546

Rabbit Polyclonal Anti-EEF1A1 Antibody

Product Images

WB Suggested Anti-EEF1A1 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysateEEF1A1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  EEF1A1 antibody in Human HepG2 using Western blot

• 

  EEF1A1 antibody in Human Hela using Western blot

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EEF1A1 antibody: synthetic peptide directed towards the C terminal of human EEF1A1. Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: eukaryotic translation elongation factor 1 alpha 1
• Database Link:
  NP_001393
  Entrez Gene 13627 MouseEntrez Gene 1915 Human
  UniProt ID P68104
• Background: This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008]
• Synonyms: CCS-3; CCS3; EE1A1; EEF-1; EEF1A; eEF1A-1; EF-Tu; EF1A; GRAF-1EF; HNGC:16303; LENG7; PTI1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome