EEF1A1 (NM_001402) Human Recombinant Protein

CAT#: TP309697

Recombinant protein of human eukaryotic translation elongation factor 1 alpha 1 (EEF1A1)

Product Images

A biolayer interferometry assay on the Octet Red machine determined the association (Ka) and dissociation (Kd) constants of purified wild-type (WT) and E300R mutant HIV-1 reverse transcriptase (RT) heterodimer with biotinylated eEF1A (OriGene TP309697) immobilized on a streptavidin-coated biosensor. The Ka is the rate of RT complex formation with eEF1A per second in a 1 M solution, and the Kd is the fraction of complexes decayed per second. The Ka divided by the Kd is the binding affinity (KD). Figure cited from MBio, PMID: 29588400

• 

  The mean levels of serum EEF1A1 autoantibody (EEF1A1-AAb) by age group in type 1 diabetes mellitus patients (squares) vs. non-diabetic control subjects (circles), as measured by ELISA using recombinant EEF1A1 (OriGene TP309697). a: significantly different compared to nondiabetic control subjects in each age group (P < 0.05); b: significantly different compared to 18- to 29-year-old in each disease status (non-diabetic control group and type 1 diabetes mellitus patients, respectively; P < 0.05). Figure cited from Diabetes Metab J, PMID: 26616590

• 

  Biolayer interferometry assays (BLI) of a biotinylated HIV RTp66/p51-loaded or integrase-loaded biosensor with 60 nM of purified eEF1A (OriGene TP309697), eEF1B (OriGene TP321264), eEF1D (OriGene TP303202), eEF1G (OriGene TP319578) or BSA as analytes. Figure cited from PLoS Pathog, PMID: 26624286

• 

  Coomassie blue staining of purified EEF1A1 protein (Cat# TP309697). The protein was produced from HEK293T cells transfected with EEF1A1 cDNA clone (Cat# RC209697) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209697 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG
  ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA
  YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW
  FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF
  APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP
  GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
  LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: ELISA capture for autoantibodies (PMID: 26616590)
  Biolayer interferometry (BLI) assay (PMID: 26624286)
  Binding assay (PMID: 29588400)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001393
• Locus ID: 1915
• UniProt ID: P68104, Q6IPS9
• Cytogenetics: 6q13
• Refseq Size: 3528
• Refseq ORF: 1386
• Synonyms: CCS-3; CCS3; EE1A1; EEF-1; EEF1A; eEF1A-1; EF-Tu; EF1A; GRAF-1EF; LENG7; PTI1
• Summary: This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome