EEF1A1 (NM_001402) Human Mass Spec Standard
CAT#: PH309697
EEF1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001393)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209697 |
Predicted MW | 50.1 kDa |
Protein Sequence |
>RC209697 protein sequence
Red=Cloning site Green=Tags(s) MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001393 |
RefSeq Size | 3528 |
RefSeq ORF | 1386 |
Synonyms | CCS-3; CCS3; EE1A1; EEF-1; EEF1A; eEF1A-1; EF-Tu; EF1A; GRAF-1EF; HNGC:16303; LENG7; PTI1 |
Locus ID | 1915 |
UniProt ID | P68104, Q6IPS9 |
Cytogenetics | 6q13 |
Summary | 'This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419954 | EEF1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419954 | Transient overexpression lysate of eukaryotic translation elongation factor 1 alpha 1 (EEF1A1) |
USD 325.00 |
|
TP309697 | Recombinant protein of human eukaryotic translation elongation factor 1 alpha 1 (EEF1A1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review