Antibodies

View as table Download

Rabbit anti-HIF1AN Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HIF1AN

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1AN antibody: synthetic peptide directed towards the middle region of human HIF1AN. Synthetic peptide located within the following region: GGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEV

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIF1AN

Rabbit Polyclonal Anti-HIF1AN Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HIF1AN