Antibodies

View as table Download

Rabbit anti-PDE4D Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDE4D

Rabbit Polyclonal Anti-PDE4D Antibody - C-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE4D antibody is: synthetic peptide directed towards the C-terminal region of Human PDE4D. Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ

Rabbit Polyclonal Anti-PDE4D Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pde4d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Goat Polyclonal Antibody against PDE4D

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence QPEACVIDDRSPDT, from the C Terminus of the protein sequence according to NP_006194.2.