PDE4D Rabbit Polyclonal Antibody

CAT#: TA345159

Rabbit Polyclonal Anti-PDE4D Antibody - N-terminal region

Product Images

WB Suggested Anti-Pde4d Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pde4d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: phosphodiesterase 4D
• Database Link:
  NP_006194
  Entrez Gene 238871 Mouse
  UniProt ID Q08499
• Background: Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
• Synonyms: ACRDYS2; DPDE3; HSPDE4D; PDE4DN2; PDE43; STRK1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Progesterone-mediated oocyte maturation, Purine metabolism