Rabbit anti-SLC25A4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLC25A4 |
Rabbit anti-SLC25A4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLC25A4 |
Rabbit Polyclonal Anti-SLC25A4 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
Anti-SLC25A4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-52 amino acids of human solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 |